DPCstruct | MC30
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 82 ± 8 aa |
| Standard deviation of domain lengths | 7.75 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 20.84 |
| Pfam Score | 96.43 |
| Assigned Pfam label(s) | CL0710- PF11823 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q60327 | 25-95 | EGKGLIIFENTKDAMRAESILKDKYKIKVVAPPPEIREGCDLAIEYELIDEFGIKRELESNDIKPLKFISL |
| A0A1L8D350 | 2-76 | RELVFLTFPSIHHLLQLEDILKEKSFKFQMIPLPREIRSDCGTCLLIEKEAVENILILAQKQGIPVEGVYPVTDE |
| A0A6N9JQ82 | 49-130 | None |
| A0A6N2YLR2 | 264-346 | None |
| A0A7V3K2J9 | 30-115 | None |
| A0A7X9A200 | 2-91 | None |
| A0A381H877 | 2-79 | None |
| M2AWK9 | 2-98 | None |
| G2IFH2 | 2-77 | None |
| A6TQY3 | 6-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.