DPCstruct | MC3
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 346 ± 34 aa |
| Standard deviation of domain lengths | 34.27 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 14.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E0QQW9 | 20-394 | LPFNKCQQEFSAIGLNSIVPGHGDPIAKWLVGGGVGRRILQIFIVLVWAAVPAFVAYLEGNFRNGNLSPDVLQDAGYWNQYALALPV… |
| A0A849WCM9 | 318-702 | DLREEIAWMHNDPIGMFFEKSRLSIFSVFAFFFILDAIVVVVWALINRSFSPYIPQSESGFWQPIVLFINQFSCDRNIMTFAEDFAG… |
| A0A812QUF7 | 17-366 | None |
| A0A517XMS7 | 20-388 | None |
| A0A1H8WFE9 | 31-423 | None |
| A0A5E4L1M8 | 5-347 | None |
| A0A2E8K7B7 | 1-274 | None |
| A0A849QJ41 | 5-289 | None |
| U2YEZ0 | 169-544 | None |
| A0A2E1VUJ2 | 11-352 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.