DPCstruct | MC29998
Metacluster Properties and Pfam Annotations
| Number of structural domains | 3522 |
|---|---|
| Mean domain length (aa) | 228 ± 44 aa |
| Standard deviation of domain lengths | 43.71 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.39 |
| Mean intra-cluster sequence similarity (%) | 12.83 |
| Pfam Score | 97.41 |
| Assigned Pfam label(s) | PF19872- CL0041- PF20985- CL0052- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3Y6B9 | 3-177 | QADICHAYQLLKKGGLKDENIVVFMYDDIANNEENPRRGVIINSPHGEDVYKGVPKDYTGDDVTVDNFFAVILGNKTALSGGSGKVV… |
| A0A2D6G0K8 | 255-494 | QKPTKQPVRTDINFGNYHALVIGINRYHNLPRLRTAVADAEAIADVLKSKYGFSVSTLINPTRTQILDRLDNLRAKLNRTDNLLIYY… |
| A0A7R9PWD3 | 4-159 | None |
| A0A7R9PZM4 | 233-479 | None |
| A0A7R9Q1B1 | 104-371 | None |
| A0A497J7N3 | 527-707 | None |
| A0A2R7SFF2 | 2-196 | None |
| A0A7S1XMI0 | 98-322 | None |
| A0A7G6A7Q8 | 40-238 | None |
| A0A3S0YXL3 | 26-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.