DPCstruct | MC29990
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 375 ± 79 aa |
| Standard deviation of domain lengths | 79.42 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 82.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.71 |
| Pfam Score | 79.95 |
| Assigned Pfam label(s) | PF13700- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q0CMV5 | 176-591 | RIYRALIEPLNQQHRNKLDELLTVKAGSNSTWLTWLRQSPLKPNSRHMMEHIERLKIFQLVALPEGLDGSIHQNRLLKLAREGGQMT… |
| A0A647ARD6 | 54-334 | ALAEPLADAHRRRLDDLLKRRDNGKTTWLAWLRQSPAKPNSRHMLEHIERLKAWQALDLPTGIERLVHQNRLLKIAREGGQMTPADL… |
| E2CIR4 | 155-561 | None |
| A0A1H6F177 | 26-400 | None |
| A0A833N4D3 | 2-288 | None |
| A0A2N3YUI4 | 149-525 | None |
| A0A840NT60 | 8-339 | None |
| A0A1S6R7B7 | 3-325 | None |
| A0A0E3B8H8 | 174-577 | None |
| A0A7W1LY68 | 2-344 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.