DPCstruct | MC2999
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 74 ± 5 aa |
| Standard deviation of domain lengths | 5.46 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 23.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16256 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X6UGL8 | 3-66 | SEIKAEVAPQYIDFLTKIIEAYENLGIVSTISRNGLVIIRGTADTIPELEMILKNLPFPLEIKE |
| E4L9F8 | 1-70 | MEDNYLYIEVRPSDVNYVNRILEGYEYLGVLTTINTQRSTCVVHTTKDTRDIAIDVLTHLDVPVKILKNR |
| A0A7C3L777 | 11-86 | None |
| A0A7G6E0F8 | 19-90 | None |
| A0A1C2XZ65 | 23-94 | None |
| A0A7Y8LN28 | 1-81 | None |
| A0A0S7Y4M3 | 1-74 | None |
| A0A2E6XVM9 | 5-84 | None |
| A0A534NDF3 | 78-154 | None |
| A0A7X8CAY2 | 4-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.