DPCstruct | MC29987
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 502 ± 63 aa |
| Standard deviation of domain lengths | 63.12 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834QR45 | 1-404 | MLWKQLEVLKDHWGQLKLGDQDISSASFHKQYSELYEADILYPSMKAIARQMGKEDEFERLIINSQSILPPKGASEIEIKTQQLQKL… |
| A0A2T7NVQ1 | 1-608 | MRHALAALSNVQRRGLFCTNVTIPEPLEARDIRAQKLFPWRTFLNTNGPFPGMFWQWSQISHNIQLCLAGLREVDRHVANGEILGVT… |
| A0A7S1DWQ4 | 52-553 | None |
| A0A3B5BGT6 | 132-622 | None |
| M3W5R8 | 2-515 | None |
| A0A5K4F3H5 | 1416-2017 | None |
| A0A1Y3NPE2 | 5-532 | None |
| A0A401PSP6 | 1-538 | None |
| A0A3Q0RLX4 | 141-588 | None |
| A0A7N9DEJ6 | 4-430 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.