DPCstruct | MC29985
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 159 ± 14 aa |
| Standard deviation of domain lengths | 13.56 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 93.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A840HSR9 | 580-740 | LDWQMINGNRGGVWAKRTPAAYSSQIAKEGVAIENMIRLANEAKVDPWFLIPYNADDEYIRNFARMVHDRIAPERTVYVELGNEVWN… |
| A0A1T4WML0 | 217-378 | MNMSGISNNPQSSWNQRQKLTDATWGGSQTNRGAPIEIQIELANRLNAHPWFTLHHAADNNYVMQFAQLVKQRLRPNLKPHVEYSNE… |
| A0A383V938 | 298-466 | None |
| A0A843YB77 | 1-176 | None |
| K9YXE2 | 248-397 | None |
| A0A418RNI9 | 286-463 | None |
| A0A3D9HRU4 | 187-339 | None |
| A0A5C7PZW6 | 169-362 | None |
| A0A7Z9N5Y6 | 196-376 | None |
| A0A316KTS6 | 190-353 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.