DPCstruct | MC29984
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 372 ± 71 aa |
| Standard deviation of domain lengths | 70.89 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.52 |
| Pfam Score | 83.12 |
| Assigned Pfam label(s) | PF16454- CL0465- CL0541 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T7NNL3 | 3-466 | AASKSHVDKDSLPANGLKEAQQQPYHVCVDSAKLDQPWFWPAIPREEAEQQLDGRPDGSFQIRKSSVKGNFTLVVRKNGDNSCIRII… |
| A0A2B4SX19 | 2-400 | SASLNDASWYHGRITRDQAIDILLHRGRQEGLFLVRNKAGGSEDNFVLSLWHGNQALHFQIQCRGGINYSIDDGPIFEGLDSLIEYY… |
| A0A1B0F9N3 | 607-1034 | None |
| A0A6A1QF04 | 259-592 | None |
| A0A6P9A5C6 | 471-786 | None |
| A0A6V7VIE9 | 6-458 | None |
| A0A3Q0DYA0 | 129-423 | None |
| A0A556TY20 | 58-309 | None |
| A0A6P8S8E2 | 327-665 | None |
| A0A7M3RVZ2 | 2-396 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.