DPCstruct | MC29981
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 91 ± 7 aa |
| Standard deviation of domain lengths | 6.90 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 43.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A124HK64 | 1-88 | MTVCSARIADRLGGVARLRESGAFKEVEELPTGSVWWRATDRLDDYTGEALRSVFRVVAPALPPGRPRPYVGREIGRLVYEDPVVDTG |
| A0A1H3FTX5 | 198-292 | RTFLRGYEWLTVCPRELAHRLGGAEGLAASGAFAEVRPLPHGAVLLRATDSPEEYRGERVHAVFAALAPVLPGGQPRGLPEHDFTRI… |
| A0A117MQF1 | 137-231 | None |
| A0A6B2TVC4 | 64-162 | None |
| A0A7H8LZQ6 | 15-97 | None |
| A0A7W7MS42 | 175-264 | None |
| A0A328NQN5 | 2-77 | None |
| A0A0Q6XTZ1 | 230-323 | None |
| A0A7Y5UBV6 | 200-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.