DPCstruct | MC29980
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 110 ± 9 aa |
| Standard deviation of domain lengths | 9.11 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 34.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q4W8M7 | 18-111 | SPHLRIVRADQVRPDDLIVSAFQPSVPGRLARADYFASGPYPARPGPYHPGCGCGVCGLPKVQGPNGTVVLTTGYPWDTCDPWPADD… |
| A0A101QMD1 | 12-118 | LNPGETAIPAGDVRKGDIVLAATIELNGHTDRLDHATPYTADPRPDDPGCGCAGHRSLTAEDRAKPLVVLYDGPIWDGACDVVPADA… |
| A0A1S6RWW8 | 1-113 | None |
| A0A2R4SVK4 | 13-117 | None |
| A0A3N4UK87 | 9-104 | None |
| A0A0H4BYQ2 | 18-139 | None |
| A0A1I6WDJ2 | 178-293 | None |
| A0A3R9V6J1 | 187-303 | None |
| A0A5R9DT80 | 208-327 | None |
| A0A6G3RZD4 | 31-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.