DPCstruct | MC29978
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 108 ± 10 aa |
| Standard deviation of domain lengths | 10.27 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 44.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0169 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K3BG01 | 5-106 | ALISAGQMYRHYLRHVVTGDTTRPAGMGLRAAQVGAGVPAGRWTGRGLAALGLVPGGIVTEPQLRRLFGQARHPDADALEAARLAAG… |
| A0A7G6Z5X4 | 1-133 | MTLHILSAGDGYAYYTSETETGDVKREAGRELGDYYTDDGNPPGVWVGSGINALGVSGMVTETQMKALFGEGLHPNAEQMIAAAQDA… |
| A0A358IQG6 | 1-105 | None |
| A0A1U7MQL8 | 20-114 | None |
| K0F0E3 | 2-107 | None |
| A0A2W6CHK1 | 1-111 | None |
| A0A233RMQ0 | 1-109 | None |
| A0A2S9PXT8 | 2-125 | None |
| Q83WX6 | 16-129 | None |
| A0A3A4KJN5 | 1-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.