DPCstruct | MC29977
Metacluster Properties and Pfam Annotations
| Number of structural domains | 73 |
|---|---|
| Mean domain length (aa) | 192 ± 25 aa |
| Standard deviation of domain lengths | 24.91 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.91 |
| Pfam Score | 97.62 |
| Assigned Pfam label(s) | PF11860- CL0244 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X6WY82 | 3-110 | GLSEYTRLSVARQICEPAAYESASWGAFQIMGFHWQMLGYKSVQEMVADASRSEGAQLGQFVRFILADDALHKALKARKWSAFARIY… |
| A0A2V3UPH4 | 644-825 | LEEARAEQMSRRLRADILAADGPGGFLDGPHLPKILFEAHIFDRETGGRFRASHPNISSRTWNRKLYVGGQGEWLRLYQAMQLDRRA… |
| A0A7R6YQQ0 | 12-196 | None |
| A0A537MJX2 | 143-340 | None |
| A0A562EW20 | 2-184 | None |
| A0A259MQS1 | 3-170 | None |
| A0A0V0QT32 | 55-252 | None |
| A0A5C6V3R4 | 19-243 | None |
| A0A2T5H0T1 | 88-280 | None |
| A0A7M3DQI9 | 14-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.