DPCstruct | MC29970
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 117 ± 9 aa |
| Standard deviation of domain lengths | 8.64 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E6P956 | 168-289 | KQSKAYCTVKIPAALAEVIDSYLMEHEAQVRGFRSRADVVVRVLTEFLEEQGRLRPLVKRRLEHVNVYESFVLVRDNLLNVSVEVAV… |
| B5IHK2 | 14-134 | DIMTPRKKERSSTDGTYIRVPKWLHEEINQLKHEMKTDSMWEAIAKLVEEHEEMEEIEHINTYADHFTLAHHGRIFNVYIRWKGNQP… |
| A0A7C4I547 | 20-141 | None |
| A0A662PNJ3 | 3-114 | None |
| A0A6B1BDA9 | 1-126 | None |
| A0A832RT37 | 1-101 | None |
| A0A075MWA0 | 8-113 | None |
| A0A7J2YA83 | 1-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.