DPCstruct | MC2997
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 74 ± 10 aa |
| Standard deviation of domain lengths | 10.43 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 31.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3G2GC61 | 39-111 | MRNVNNKLRRNYRILSDINLEGKTKIAKSKLSGLGFDFNYFTQIKVYKNGSEYKFIYDQGYKLLDDDYILIVK |
| A0A4Q5RER3 | 2-69 | LRHNRQILKERLGDETKLIISKADLIEAGFHFGYCTSVFSKEMNIYRFCYDYGWLEVENGKILLVKNE |
| J1FF33 | 1-93 | None |
| A0A3S9PBA2 | 46-127 | None |
| A0A1T5H404 | 119-193 | None |
| A0A7Y2H6F2 | 1-52 | None |
| A0A353VTH5 | 26-98 | None |
| S7VB66 | 11-97 | None |
| L8JJC5 | 3-60 | None |
| A0A162NTD1 | 97-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.