DPCstruct | MC29967
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 114 ± 14 aa |
| Standard deviation of domain lengths | 14.37 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J2YA29 | 2-115 | RGKPFILSADRSLMSHYRDDVLFGFIACMPAEKVNKRIYEQVFCPSVEFNKGSGEAYVAPLGLRRVEAGLMYGFDRKDIFLAHPDHL… |
| A0A257A3A9 | 1-104 | MDGVDVLLTADRTLMSNHHGKEFLGFATSAPPNWLPEWLFRYLFFPKMKEKDGLPWQAPYGLRKIEAKLIDEGIDALVVDPDSLARY… |
| A0A849R344 | 1-143 | None |
| A0A7G9ZB72 | 1-142 | None |
| A0A7J2V8M6 | 3-114 | None |
| A0A0F8Y1T5 | 9-114 | None |
| A0A257MDJ1 | 10-122 | None |
| A0A497IV18 | 4-109 | None |
| A0A520KTJ3 | 1-95 | None |
| A0A7C5PV48 | 1-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.