DPCstruct | MC29966
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 138 ± 20 aa |
| Standard deviation of domain lengths | 20.20 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 32.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832J936 | 13-147 | AERIKKLYGKSIVLKEDLFGSTPPSALLTEINYPKISLGVLIAEDKDTEIYDNPLLWTEKEISIESISAMRARLINARRIVDVFLPR… |
| A0A7C3XQD3 | 28-148 | LPYNIKLTGEVSKLCLICKGGRMLCGKLRCPIIAKAKLVVKSSSLISSERVEGSTPPGSFVGRIGYPKVYVGPMLPPYFGNTKILDT… |
| A0A3G1A7Y0 | 1-120 | None |
| A0A2K2VFN4 | 2-159 | None |
| A0A520KUN9 | 1-164 | None |
| A0A2R6BVH5 | 1-154 | None |
| A0A7C7Q5B3 | 2-134 | None |
| A0A662S028 | 38-165 | None |
| A0A075WDX7 | 6-130 | None |
| X1NFX4 | 1-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.