DPCstruct | MC29963
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 81 ± 7 aa |
| Standard deviation of domain lengths | 7.13 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W7BPA7 | 60-144 | ATSDTGGNVVLPVLSISGSEDGLSTPEKIRDAAPLLPSEAQFVEVAGAAHASFGDYGPQAGDGTPSIEDADMTAEITASVAGLLP |
| A0A2R6HUS3 | 179-253 | LAVLSVTGSRDTVLDREAYAGGRNRLPADAQFHEIDGVNHSQFGSYRGQRGDSPGSVGDDEAHDRIAAVVVDWLA |
| A0A4Y9L6C2 | 160-239 | None |
| A0A091BYB0 | 1-75 | None |
| A0A354B192 | 326-414 | None |
| A0A7W4CZS3 | 288-365 | None |
| A0A845LP07 | 173-245 | None |
| A0A2E8RZB0 | 314-399 | None |
| A0A832ILA8 | 2-74 | None |
| A0A7S2E9T4 | 1-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.