DPCstruct | MC2996
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 226 ± 21 aa |
| Standard deviation of domain lengths | 21.14 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P6Y9P8 | 176-400 | DLESIIRFNKDKKSKFLYSIQHQDRNKVGKVFIQTESGLLVKENGKVIFIDQLARSATNLPMYITNGNTPVGLYKINSLHKSENVFI… |
| A0A4Q5REQ6 | 15-237 | GRKVVYSFQRWNRDYPGLAIIQHADGRFARDGSGRLLVFQQLARSASDLPYFITNGSTPQGVYSLLGTAVSKINWIGPTPNLQMGLP… |
| A0A3C1M2B9 | 3-205 | None |
| A0A4Q3RSV1 | 66-307 | None |
| A0A3C0ISI0 | 46-254 | None |
| A0A7X9KNF4 | 1-174 | None |
| A0A3B9KU46 | 20-245 | None |
| A0A7X8M637 | 720-944 | None |
| A0A444IQI8 | 88-335 | None |
| A0A351PXS3 | 7-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.