DPCstruct | MC29957
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 110 ± 5 aa |
| Standard deviation of domain lengths | 5.13 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 56.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X3ILN6 | 33-143 | MQLNLWRRGLAQQRPLAEWLPVCRDLLNDFFLPDSETEAALALIEQQWLAVIDSGLEAQYGEQVPLTLLRDELAQRLDQQRISQRFL… |
| A0A376KMH4 | 397-501 | MQLNIWRRGLAQERPLEEWLPVCRDMLNAFFLPDAETEAAMTLIEQQWQAIIAEGLGAQYGDAVPLSLLRDELAQRLDQERISQRFL… |
| A0A379WP12 | 1-110 | None |
| A0A4P0YFC7 | 174-279 | None |
| A0A381GCJ5 | 284-388 | None |
| A0A485JC71 | 1-110 | None |
| A0A379B950 | 1-120 | None |
| A0A090QWX5 | 2-107 | None |
| A0A8A7R5Q6 | 96-205 | None |
| A0A4U9IHI4 | 101-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.