DPCstruct | MC29956
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 88 ± 9 aa |
| Standard deviation of domain lengths | 8.86 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 39.47 |
| Pfam Score | 90.91 |
| Assigned Pfam label(s) | PF02508- CL0344- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6WF02 | 7-95 | DSLLLPAIVLAATGAVFGLLISLASIAFAVEIDDRVESVREMLPGYNCGACGYPGCEGFANGIVFEGAELTRCKPGKQDMRDKIKAY… |
| A0A2X3IL09 | 127-204 | MSAVWIAVIAISLLGLIFGLILGYASRRFAVQDDPVVEKIDELLPQSQCGQCGYPGCRPYAEAVGVQGEKINRCAPGG |
| A0A376RJX1 | 1-67 | None |
| A0A266Q377 | 11-95 | None |
| A0A3A4WHV6 | 2-80 | None |
| A0A7X6VQ99 | 1-96 | None |
| A0A2G8DM53 | 1-94 | None |
| A0A0S2ZRB0 | 1-98 | None |
| A0A011QZ63 | 1-87 | None |
| A0A496QMV7 | 6-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.