DPCstruct | MC29952
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 120 ± 18 aa |
| Standard deviation of domain lengths | 17.66 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 53.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B7XN17 | 36-142 | KAEIVRLLPAKVPDRNGWAQDIYTAFDTQKIYPSTENICAVLAVTEQESTYQVDPPVPNMGKIAQDEILRRAAKVHVPAFVVRNALQ… |
| A0A2X3GL49 | 42-154 | ASVVRQKMPASVKDREAWAQAIATAFDSQKLAPTEENVCSVLAVAQQESNYQSDPVVPGLNKIAWQEIDRRAEKMHIPPFLVHTALK… |
| A0A377AZ54 | 367-510 | None |
| A0A377M5Q0 | 1-114 | None |
| A0A656GWY0 | 2-163 | None |
| A0A345ZPD3 | 1-105 | None |
| A0A377Z262 | 1-114 | None |
| A0A7Y9QZ90 | 92-207 | None |
| A0A1Y1QIT1 | 61-176 | None |
| A0A1G8NY11 | 183-329 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.