DPCstruct | MC29951
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 86 ± 5 aa |
| Standard deviation of domain lengths | 5.37 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X3GFJ3 | 1-92 | MGSLFKQIYRYTRPRAYRHNENLWPFTRITRAPSGEISALRYKGKTVPLVSLSALKNSMQGEVLLTATGPSTRNIDFSLLSKTIPVM… |
| A0A7W4F5V1 | 1-91 | MGSFLKQVYRYSHSRPYRHNENLWPYVKIERADSGEIAELHYKKQTVPIVTLSALKDSCKGPILLTATGPSVNSVRFSELPEMPAIG… |
| A0A1I5E2A1 | 19-101 | None |
| A0A485CQ72 | 11-93 | None |
| A0A2X5SPJ5 | 1-90 | None |
| A0A447LA30 | 1-88 | None |
| A0A5E4RDF0 | 5-88 | None |
| N8QAD2 | 12-95 | None |
| A0A377TL30 | 1-94 | None |
| A0A2S8QWM2 | 19-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.