DPCstruct | MC2995
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 145 ± 18 aa |
| Standard deviation of domain lengths | 18.34 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0319 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A540X389 | 7-150 | TGDESPPPRWEVFSRGGEVAVRGEGRTPEVAFEQVALALCTRVTDPSTVEVREEVDVVCDAVDREGLLMDWLRSVVQLMGSRRLRFR… |
| A0A2K6AJY3 | 14-158 | AQEEEDVRDYNLTEEQKAIKAKYPPVNRKYEYLDHTADVQLHAWGDTLEEAFEQCAMAMFGYMTDTGTVEPLQTVEVETQGDDLQSL… |
| A0A419IBD9 | 21-172 | None |
| A0A1I8IEI0 | 9-154 | None |
| A0A2I2Y839 | 1-135 | None |
| A0A4Y7N9D9 | 9-174 | None |
| A0A7V3HK68 | 300-458 | None |
| A0A4Y7M6H8 | 8-141 | None |
| A0A0V1A7T0 | 288-445 | None |
| A0A3A0GCE1 | 129-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.