DPCstruct | MC29944
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 94 ± 7 aa |
| Standard deviation of domain lengths | 6.73 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 32.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7A154 | 180-276 | FKKFRDAKTPGAQREAEVDVKKTTNLMNMLKRAVKRGFKADYLLTDSWFFNVALIKLISKLNKKHGINLLSMVRMGAAKYCLVSNNR… |
| A0A328F7X2 | 141-235 | NPDIDKRTCGYHRRQEAVTKSTAHLVPMVEKALDKGVRAKHVLMDSWFSMPSVIADLREHIHVICMLKDHPKWCYEYQGKKLSCPTS… |
| A0A7D4GDI8 | 67-160 | None |
| X6Q1B2 | 110-196 | None |
| A0A174E3Q4 | 186-275 | None |
| A0A843K5C1 | 183-273 | None |
| A0A832BL36 | 6-102 | None |
| F0K2Z9 | 20-121 | None |
| A0A1I6D457 | 1-98 | None |
| A0A4Q4II47 | 82-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.