DPCstruct | MC29943
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 336 ± 26 aa |
| Standard deviation of domain lengths | 26.33 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 14.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D5EXY2 | 1-295 | MLLAVIGFTVCDNKSIEDLNGEFSNITFCTFNNGSVQPTTKLGKGIKALNTQFTDAAGNSLSLSFGSKEWILNEGTYQPVATLTTGG… |
| R5UBH8 | 1-355 | MQIFRKSLLLTAALALTAFAACSNDDNENGGDGGETDPDYLALPHAYGTYYHTYWGDAAGDYYLVLTDADLDQADAAPYKYRLDIDF… |
| A0A1Y3VA41 | 143-465 | None |
| A0A6C9G3I2 | 1-310 | None |
| A0A1Y4ABW8 | 409-721 | None |
| A0A352HQM7 | 39-373 | None |
| A0A0A2EI74 | 1-374 | None |
| A0A496L9P6 | 4-348 | None |
| A0A1H9CXK9 | 1-372 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.