DPCstruct | MC29942
Metacluster Properties and Pfam Annotations
| Number of structural domains | 116 |
|---|---|
| Mean domain length (aa) | 264 ± 60 aa |
| Standard deviation of domain lengths | 59.76 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 89.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 17.12 |
| Pfam Score | 65.52 |
| Assigned Pfam label(s) | PF01955- CL0404- CL0635 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A523ACE5 | 6-181 | YFVYDDTLVIRGDFFGVSTGILGGWKRVCSAFNHTVGIEFYKMDPAEYLRMIARKYGLKKYFGLLTAVPMERLSVNSSGAVTAFVTA… |
| A0A2E3B030 | 3-265 | KIIKNGSITTPKGFKAGAVYAGLKSPGEDKYDLGIIYSSSPSNWAGVFTKNKIVSPSVVLSKSLPDIIQGVVVNSGSANCCVGDQGM… |
| A0A1T4K3F6 | 19-273 | None |
| A0A3C1WIL8 | 3-261 | None |
| A0A256YX45 | 4-274 | None |
| A0A4V4LZ02 | 826-1096 | None |
| G0PZP6 | 27-251 | None |
| A0A843DJU2 | 5-198 | None |
| A0A7S4UYU9 | 5-233 | None |
| A0A524I2C9 | 8-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.