DPCstruct | MC29940
Metacluster Properties and Pfam Annotations
| Number of structural domains | 722 |
|---|---|
| Mean domain length (aa) | 110 ± 17 aa |
| Standard deviation of domain lengths | 17.36 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.22 |
| Pfam Score | 97.80 |
| Assigned Pfam label(s) | CL0418- CL0167- PF19808 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A524BJ74 | 5-83 | ITGYVYFFVDEINLKVKIGFSKYPSQRLKTIQTSYPGTLVNKKTIPGSQLDERKYHRLFVHSKIKREWFNLSEEIKSFL |
| A0A2E0WJB0 | 23-123 | RTFKEFYIKYLMTFVYILTNPSFTPVKLGYTGNLKQRLGILNSSVPTKFNVHYKHKVDNPRLARRIEREVHKDYCEYRADNGEFFNV… |
| A0A1V5ZDA5 | 2-88 | None |
| A0A7W4GD26 | 123-234 | None |
| A0A810LVT7 | 723-830 | None |
| A0A1J9QW07 | 380-498 | None |
| A0A1X0U8Z2 | 2-92 | None |
| A0A7G8GL56 | 284-380 | None |
| A0A1T3NL13 | 30-111 | None |
| A0A543IL01 | 152-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.