DPCstruct | MC2994
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 162 ± 10 aa |
| Standard deviation of domain lengths | 9.70 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F1FNP8 | 242-409 | RDSGSHTALILAGMWGAKAGAVPDMQERIQNFVDEGYPSRHFADQDFLEKELWAYIRQNLFAHDRLFDFCNAHEIPGEFYSNYQIAF… |
| A0A834IBN4 | 1-162 | MRDYFSHTELILAGMWGGTRGAIHHIETLITDYIQTGNYLAKRVMDQHFLRYCIYPIIKQSMLHHDSLFEIQGSQPFPEHPIRDNYE… |
| A0A371YSD4 | 57-214 | None |
| A0A2K0XS04 | 65-236 | None |
| A0A6G6J0B2 | 158-311 | None |
| A0A6N6XCI2 | 1-141 | None |
| J9KBB9 | 268-424 | None |
| A0A315AS20 | 40-214 | None |
| A0A376BTU2 | 243-414 | None |
| A0A376BK32 | 315-483 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.