DPCstruct | MC29937
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 81 ± 9 aa |
| Standard deviation of domain lengths | 8.83 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 72.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 69.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00786 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3AXM3 | 8-73 | RHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDKETSKVIYDFIEKKGGVEAVKNELRRQ |
| A0A4W3JZM0 | 1-83 | LILFFLRHRGHVGWDPEKGFDLNNLDPDLVKVFIQAGINEFHLKDKETSKMIYNVLENKGEINAAQKDAKQKGKENLCTDKYC |
| A0A553NRR4 | 1-77 | None |
| A0A2D0QFM1 | 1-90 | None |
| A0A3B4BIV8 | 140-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.