DPCstruct | MC29934
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 59 ± 3 aa |
| Standard deviation of domain lengths | 3.03 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 84.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 54.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0188 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W3JE52 | 4-64 | RPLKLAGIFLTDIYTELKDGIALIRLLELISGEQLPRPSRGRMRVHYLENNSKAIHFLRTK |
| A0A183IX96 | 71-124 | LEIADLFIDLCDGILLMKLLEIISGDKLGKANRGRMRVHKIENLNRVLDYLKRK |
| A0A7R9P0T7 | 54-109 | None |
| A0A0M3IWU1 | 1-60 | None |
| A0A4Z2HII1 | 163-223 | None |
| A0A2I4D4S6 | 70-129 | None |
| A0A4C1UMJ5 | 216-273 | None |
| A0A653BZ80 | 100-155 | None |
| A0A7J7WUJ7 | 227-285 | None |
| A0A7E4S6N3 | 16-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.