DPCstruct | MC2993
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 68 ± 5 aa |
| Standard deviation of domain lengths | 5.27 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 43.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A194Q2C2 | 117-183 | TVGLTKTYCVNSQIADSACTATAYLCGVKNNNGMLGLTAAVPRRDCAAATEPATHLESIAAWALAAG |
| A0A212D327 | 25-98 | SLAMDQFPYMALSKTYNVDRDVPDSAGTATAYLCGVKGNYGTIGVSAAARFDQCNTTHGNEVTSVMNRAKKAGK |
| A0A1D2N1M5 | 32-103 | None |
| A0A4Y2TY49 | 24-89 | None |
| A0A0Q4IM14 | 52-125 | None |
| A0A2C9JPL6 | 92-160 | None |
| A0A820TGF8 | 102-166 | None |
| A0A663MZR9 | 230-294 | None |
| A0A4Y2LPL6 | 82-149 | None |
| A0A7J7JFE8 | 90-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.