DPCstruct | MC29929
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 257 ± 53 aa |
| Standard deviation of domain lengths | 52.90 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 88.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 26.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12006 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I4ZLQ7 | 118-401 | ITEAAEAFLRNLEDPDQRAQATFSFDHGERENWHYVPRPRAGLSRGEMLPAQLNAAESLMAVSLSVEGVRKAHSIIRHETILGEMEA… |
| A0A4R5TL09 | 196-525 | NPENTPRFPALPASTPPADLQTLRIVAAAEDFLATLTARQRAAILFAFDDRAQRARWSNLPEGLFERRGLRWAELTAEQRAALRDVL… |
| A0A482ZVV4 | 5-223 | None |
| A0A075TUP1 | 58-320 | None |
| W6YM15 | 41-353 | None |
| A0A7X3RIU1 | 26-255 | None |
| A0A2N1G8I1 | 4-193 | None |
| A0A1I3X9C5 | 44-287 | None |
| A0A800MB58 | 2-156 | None |
| S3ZHY5 | 17-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.