DPCstruct | MC29928
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 65 ± 4 aa |
| Standard deviation of domain lengths | 3.71 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P7SUR3 | 1-65 | MIIRHDDWSRLIGATVEIRRQGDPVRTGRVDHATKDSNILWLAQEGNNPRKMIDKAQGYEAWAVS |
| H0QTW2 | 1-69 | MKNQLHLQHDWGPVAGELVEIRHGGQAVRAGIVDGVTADGGILWLAAQGAEPRSMFERSQGFSVWIEYR |
| A0A1I7DJW0 | 2-70 | None |
| A0A7X0GDT0 | 2-65 | None |
| A0A4R5K7L6 | 72-131 | None |
| A0A4R7L4V6 | 6-66 | None |
| A0A542IPH0 | 43-103 | None |
| A0A8A3R294 | 193-255 | None |
| A0A175J8R1 | 7-77 | None |
| A0A7X6K7F4 | 32-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.