DPCstruct | MC29920
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 290 ± 46 aa |
| Standard deviation of domain lengths | 45.63 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 25.10 |
| Pfam Score | 66.67 |
| Assigned Pfam label(s) | CL0001- PF08434 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A195B061 | 88-324 | LDRNRVIRDVAYFIRAHKFHDYDHRYFKSAEEATSKLYEEFPKPGLRSLHWEVHKHCEASFVECLKYLERIIKLTVFRRENDTVTIM… |
| A0A811KUW8 | 15-308 | LVIAQNPLDIDLEADLSTLNQNTLKEFNEQWNGTPASERSQLLQRLGKIALFMRLYRKFAPDPNNGKVEFEYLFPKPEPAFHKEILD… |
| A0A2P8YJB0 | 26-289 | None |
| T1FAQ4 | 8-300 | None |
| A0A7I8V4R9 | 2-244 | None |
| R7UCH3 | 46-366 | None |
| A0A044SAN2 | 33-350 | None |
| A0A1I7RHW1 | 15-313 | None |
| A0A834N5E9 | 36-453 | None |
| R7V7T3 | 32-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.