DPCstruct | MC29917
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 585 ± 123 aa |
| Standard deviation of domain lengths | 122.58 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 87.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.83 |
| Pfam Score | 78.89 |
| Assigned Pfam label(s) | CL0369- CL0036- CL0026 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G4SFN2 | 1-507 | MVPKWMGPITEWANLLETVNYSGYNMIHFVPLQKRGVSNSPYSISDQLSFDDDVFDAKDQKKSNKERLAVVKKAIGNIYSKHGILSL… |
| A0A811KD39 | 37-563 | GRKLLGRKLTLKIPKLDKKFEFPELKALSDFDYHVDLLCDTFGSFKYEFQVEGDSESNGSGYFTVQPEWEVNGKKLSLNSLAVQTYL… |
| A0A443QM95 | 2-686 | None |
| A0A182T4T2 | 36-687 | None |
| A0A368FI50 | 1-504 | None |
| A0A3P8AVF1 | 2-691 | None |
| U6N4S6 | 2-466 | None |
| A0A2H2JNG9 | 1-473 | None |
| A0A0N4T450 | 13-669 | None |
| A0A2H1C542 | 1-382 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.