DPCstruct | MC29913
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 86 ± 9 aa |
| Standard deviation of domain lengths | 8.51 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 39.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7S825 | 70-151 | LKMIQFEVNKILEYAQILHFENDMCAICLEEKAQNPVYCIQCLKIVSCKGCTDDLVRHSGHFVKCPRCQRKSPTELPLFYCA |
| A0A811JQH2 | 1-102 | MEMLNLATDLLITSMNRKPENNPCHLCLIDQAKAPVFCLQCLKIVSCKWCFLLYLTEEPTNAVKCLNCQRISPKECSLFARVYRREA… |
| A0A7I8XFI7 | 90-165 | None |
| A0A811LEN2 | 113-190 | None |
| A0A1I7SBF4 | 172-258 | None |
| A0A1I7S7Z0 | 243-319 | None |
| A0A7I8WND0 | 129-208 | None |
| A0A811JQ81 | 61-154 | None |
| A0A7I8X9R7 | 79-169 | None |
| A0A1I7S0D2 | 1-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.