DPCstruct | MC29911
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 90 ± 11 aa |
| Standard deviation of domain lengths | 11.26 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05800 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E3Q8W2 | 16-96 | MEELNNATSLIESITRKKAEGVVSMSREEGILKLLVEVLERKSIPDSQDILSIYEMKLNSNMDIIDYSKIGMRRRSDMFTQ |
| A0A2M8S9B8 | 5-85 | LEIAQRAKEQLAQLTGLTPETVSALSKDEQGWHVTVDLIELKRIPESTDVLATYGVVLDEAGNMLSYQRTRRYYRGEITEQ |
| Q02240 | 38-139 | None |
| A0A1N6YIH6 | 52-135 | None |
| A0A7D5KEW6 | 119-227 | None |
| A0A1G3AGE2 | 11-99 | None |
| W8HG56 | 6-104 | None |
| A0A543MAF4 | 65-161 | None |
| A0A4R6VHH2 | 304-394 | None |
| A0A1B1K7M3 | 5-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.