DPCstruct | MC29909
Metacluster Properties and Pfam Annotations
| Number of structural domains | 143 |
|---|---|
| Mean domain length (aa) | 303 ± 61 aa |
| Standard deviation of domain lengths | 61.11 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 84.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 17.23 |
| Pfam Score | 92.08 |
| Assigned Pfam label(s) | CL0020- PF17306- PF02185 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3U699 | 32-348 | SFVQELDAWRKKIGQLRFSTQGPAQCRDGALHYYKLVTHAEHHFRGSSLKELKLLFRWHDTFNPKLSVAQPDWRFERAAVLFNIAAS… |
| A0A397Z9U4 | 39-309 | NLNIRWSSGLNLDCKSSNGLSLASIFQPKSTPFFQSKDMLFELHMILFIYALKLREKAMVLASKDMVESTKAYREAAGVFDSVCKIG… |
| A0A067C1T8 | 17-440 | None |
| A0A0N5D9P3 | 60-362 | None |
| A0A1S8VTQ4 | 179-459 | None |
| A0A452T0F0 | 105-484 | None |
| V4BWU0 | 40-357 | None |
| A0A177W8E8 | 654-914 | None |
| A0A2G5U9P1 | 41-353 | None |
| A0A7S3GBG4 | 31-333 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.