DPCstruct | MC29907
Metacluster Properties and Pfam Annotations
| Number of structural domains | 104 |
|---|---|
| Mean domain length (aa) | 118 ± 19 aa |
| Standard deviation of domain lengths | 18.66 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 15.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19686 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P7RPC7 | 5-115 | LQSRRVTRVLLDFDLSIEFAGGATVAFSEFVIGDVLVDEDNQFEGLRLAAALVGRLCESVAYAESGELTIVFDDGTVVEAASREEVE… |
| A0A1X7BXB2 | 20-141 | STLVNQKCLSIVRRENDWLIEFSEDAFIELYVPWRIVSGGRIVFSDEDDGQLFGLSEPKNGEEIAKSFLRSKKISTVTTDRETGDLS… |
| A0A248L843 | 14-147 | None |
| S4NDM9 | 9-99 | None |
| A0A559JCF9 | 9-105 | None |
| A0A2V7S100 | 5-142 | None |
| A0A1M5PXR2 | 9-130 | None |
| A0A5E8HBE4 | 9-142 | None |
| A0A1X0UNG9 | 32-141 | None |
| A0A2V7YHD9 | 72-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.