DPCstruct | MC29903
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 136 ± 23 aa |
| Standard deviation of domain lengths | 23.49 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B9UWE3 | 13-164 | YTTTPKALDSAIIDFCREVSPGVEPRYLPVRPDPISQPSECFNNVMARVSKEGGNLVYGWLVWEWPNVFIEAEHHAVWQSSDMLVDI… |
| A0A0R3E027 | 1-150 | MLVRSLSDATLAAIGKEVSQQPIELVTHQPKPWALPTDCFRNVARKIAEDRGSAQCGYTFHHRFAQKIEGHPLYIYLTHHAVWVSPK… |
| A0A6L4B5V5 | 2-138 | None |
| A0A3C1RDM4 | 1-145 | None |
| A0A813AZZ3 | 27-188 | None |
| A0A7S2NB61 | 30-166 | None |
| A0A437J5I5 | 20-155 | None |
| A0A318AMY6 | 1-150 | None |
| A0A1H8Y774 | 12-192 | None |
| A4YYC6 | 19-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.