DPCstruct | MC29901
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 143 ± 16 aa |
| Standard deviation of domain lengths | 15.62 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3MJE8 | 112-253 | SRQAAAADPIFAAIDSHKRAFTAYDVEMPRTDELEEAIPSNRRQTTTAELDNPAEDDDPQWVQHQRELHRLREAESEAECVLASVVP… |
| A0A0R3D127 | 1-167 | MNMLVSAAVTGTAIPQAGVSAAGADPILAAIETHRQVCEQLSKEVGRHSALESEIPLEKRQSEVNPWEDEFIVDTDDPRWIASERAL… |
| A0A1X3GES4 | 31-184 | None |
| A0A0R3N855 | 1-148 | None |
| A0A4Q0SC36 | 3-129 | None |
| A0A3A0EZM1 | 176-303 | None |
| A0A109JSJ7 | 1-165 | None |
| A0A839Z7A6 | 6-145 | None |
| A0A1G7QZ23 | 80-195 | None |
| A0A1N6L9C5 | 29-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.