DPCstruct | MC29887
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 58 ± 2 aa |
| Standard deviation of domain lengths | 2.45 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 97.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 54.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5Y6D3 | 69-123 | IGVCLDTCHVNDAGYDIVNNLDGVIEEFEKIIGLEKLKAIHINDSMNAIGSHKDR |
| K1TL48 | 1-63 | MKKVGVCLDTCHVFDAGYDIVNSLDEVLTDFDRIIGLEKLRAIHINDSKNPLGSHKDRHECIG |
| A0A397T9S4 | 182-238 | None |
| A0A2C9JFR1 | 1070-1127 | None |
| A0A2P4Z650 | 235-292 | None |
| A0A2T7I2I7 | 486-542 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.