DPCstruct | MC29884
Metacluster Properties and Pfam Annotations
| Number of structural domains | 2919 |
|---|---|
| Mean domain length (aa) | 158 ± 27 aa |
| Standard deviation of domain lengths | 27.49 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 12.37 |
| Pfam Score | 93.74 |
| Assigned Pfam label(s) | PF00057- CL0110- PF05461- CL0111- PF01915 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S7LHE3 | 100-237 | FRSRGKLLGYGRLQVQKSGYCLDVEGNQGRGNVLIYNCEHAADQYFKFYKNGELVNKKSGLCVDIKGNNGYGDISMHACKDLPDQMW… |
| A0A402D0N4 | 20-183 | LAGMPACAQDPASEAQGVTYQLINVNSGKVADVAGSSVTAGAQVFQYTYHGTKNQQWKVLPVDGGYWEIANVNSAQALTVVDTPTAN… |
| A0A1Y6BJA6 | 123-255 | None |
| A0A1Q9C7T4 | 34-234 | None |
| A0A1Y6C1D9 | 383-581 | None |
| A0A1Y6BZW0 | 19-179 | None |
| A0A1Y6CVD1 | 152-305 | None |
| G8S9Z4 | 76-239 | None |
| A0A1Q9C146 | 541-690 | None |
| A0A1Q9C564 | 1109-1276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.