DPCstruct | MC29883
Metacluster Properties and Pfam Annotations
| Number of structural domains | 166 |
|---|---|
| Mean domain length (aa) | 150 ± 20 aa |
| Standard deviation of domain lengths | 19.92 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 15.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11033 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A402D0A7 | 6-157 | YMTEHHYNIFADYHQFYLQDEKADGDLSDCWTHEATEQMLALAPGTIGVGTVRNMTVPVTVRVLDAAPADDYDQWDQVNECSLDIPS… |
| G4F056 | 3-104 | WTDEAIEKGYAAADGAISFEAQRNTKAFILLRLNSSETVSSYEKKVTVPFHVTENGIHIESIMSKRLSFDLPKGDYQLTCWTVPAEM… |
| A0A2S8ZW86 | 3-155 | None |
| A0A7T9ICT9 | 8-155 | None |
| K2IY25 | 1-154 | None |
| A0A1G9S3Y4 | 22-127 | None |
| A0A2X3L2T4 | 299-471 | None |
| A0A7W7FVL5 | 5-158 | None |
| A0A518AM00 | 2-135 | None |
| A0A7W3W443 | 6-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.