DPCstruct | MC29877
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 68 ± 9 aa |
| Standard deviation of domain lengths | 8.72 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 46.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E1HVE5 | 1-66 | MCNLYSQKNSLQEVRDWFRVDVVDASAGNLPPLNSIFPGYDAPVIYRKKSERILGMMKWGFVLIQK |
| A0A0B4XAY5 | 1-82 | MCNLYRMLSNQAAIRAITRAIIDSTGNLQPIEEIRPERMAPIVRNTPAGRELANVRWGLPSSSQALFRQLPSERTLYERKAR |
| A0A2S5U2T2 | 1-68 | None |
| A0A839P7R3 | 1-65 | None |
| A0A2T4Y9D2 | 1-82 | None |
| A0A2U0U801 | 1-55 | None |
| A0A418ZZP6 | 84-148 | None |
| A0A1V0PWN7 | 109-178 | None |
| A0A1K2I4M1 | 114-183 | None |
| A0A7C4VG34 | 70-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.