DPCstruct | MC29876
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 164 ± 31 aa |
| Standard deviation of domain lengths | 30.68 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12008 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A095YD56 | 27-184 | LLRQAEVNVDYILMLVEKFREPMLKSQVPDYQYKEQVLQAVESSPTLRDKRDLFMDFIELVNTDASVAEQWVAFISQRREQELGTLI… |
| A0A809T301 | 4-153 | SQEINLDYILGLIFEHNRQNKGKGEMIEEVKRLIRSSLGNRAKEGLVVDFIQQTNLDDLPDKASIIDAFFTFAQHEQLREAEALIKE… |
| A0A6J7H0N9 | 70-228 | None |
| I6ZIC7 | 51-281 | None |
| A0A3E0DY48 | 88-245 | None |
| D6SWK4 | 3-140 | None |
| A0A7T8M3P6 | 1030-1215 | None |
| A0A1A0JTP3 | 4-120 | None |
| A0A6C1QSC2 | 116-281 | None |
| A0A1V5J2E1 | 2-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.