DPCstruct | MC29875
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 67 ± 11 aa |
| Standard deviation of domain lengths | 10.64 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 78.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0238 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6LCX6 | 1-53 | MYDKLRRSRRLDAVQSGCFALSIVKQGDLMLVANVGDSRVVLGTAFNDDTINV |
| A0A3L6DNN5 | 1-79 | MLGDCEFDLWKQSYVAACAAVYDKLRRSRRLDAVQSGCTALSIIKQGDLMVVANVGDSWVVLSTASDNSTITPSSSSST |
| A0A804RGC0 | 39-117 | None |
| A0A317Y315 | 1-60 | None |
| A0A1D6PRZ0 | 1-65 | None |
| A0A3L6FC18 | 12-89 | None |
| A0A3L6F473 | 26-102 | None |
| A0A804M0P6 | 138-190 | None |
| A0A804PVL9 | 1-59 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.