DPCstruct | MC29873
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 242 ± 36 aa |
| Standard deviation of domain lengths | 35.91 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.85 |
| Pfam Score | 98.39 |
| Assigned Pfam label(s) | CL0020- PF12842 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L6D951 | 3-243 | NNISISNMEAKAKEFNEVIIQEQYYPWFAQYMVMKRASIEPNFHDLYLKFFDKVNSKSLNKEILKATYENCKVLLRSDLIKSSSEER… |
| A0A2P2MSE6 | 176-384 | NIGTLEAAAERRTPIETPASETQDKISFIINNISSANVEAKAKEIPEILKEQYYPWFARYMVMKRASIEPNFHDLYLKFLDKVNSKA… |
| A0A6V7PPE6 | 320-580 | None |
| A0A3L6DB33 | 83-315 | None |
| A0A3L6DNK2 | 95-399 | None |
| A0A1D6P0G0 | 1-256 | None |
| A0A1B7NZN4 | 287-571 | None |
| A0A3L6D7R4 | 3-207 | None |
| A0A452Y250 | 16-224 | None |
| A0A4Z1IT97 | 796-1029 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.