DPCstruct | MC29871
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 153 ± 16 aa |
| Standard deviation of domain lengths | 15.87 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 73.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 32.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q0DH60 | 291-450 | MPESFYTNGGLKLRVVWTISSLIAASTRHYLLRSIIKDHPTLTSLVLTDADGQGTLSMGAEQLKEFRENQLSASACSNRTQVPACNM… |
| A0A317Y8L2 | 32-156 | LRSIINDHPTLRSLVLADAEGQGTLSMGAEQLNDFREHQLSASPCSNRTQVPACNMKLKYAQYLELPGGLALQGATLLVIKPASHGH… |
| A0A834L6J9 | 152-294 | None |
| A0A834L659 | 159-315 | None |
| A0A6A2YW16 | 179-339 | None |
| A0A0B2PH00 | 41-166 | None |
| A0A6P6FWY1 | 175-312 | None |
| B9ET82 | 689-851 | None |
| A0A2P5DR87 | 220-387 | None |
| A0A834L7S5 | 282-434 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.