DPCstruct | MC2987
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 204 ± 23 aa |
| Standard deviation of domain lengths | 22.99 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12333 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A420ITN1 | 110-306 | LLYIRAGMTHLSLDIRTDALAFLEWLLEVAEEEVVGCAGGWFKVLKCFMSIMGWAATTETSKWTSGIKVTFPKAGKAYPYQLLVFSK… |
| A0A022W3G5 | 2-189 | THLAADIRLSSVEILSWLLSVAGQELVSAAGGWVKTLNCFLSLLGWHTESSTKWSSNKTSFGKSGSEGKLTARVLQIFAEFLQAGIG… |
| Q6CHC5 | 178-406 | None |
| A0A167FXC2 | 2-229 | None |
| O94718 | 103-345 | None |
| A0A0W4ZJY1 | 54-267 | None |
| A0A3N4JDS6 | 143-352 | None |
| M7NSU2 | 28-223 | None |
| A0A642V4D7 | 36-235 | None |
| A0A1E4TDU1 | 3-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.